General Information

  • ID:  hor004783
  • Uniprot ID:  A0A0A8KZI7(44-55)
  • Protein name:  RVAL-(L1, T6, L8)-bradykinin
  • Gene name:  kininogen
  • Organism:  Limnonectes fujianensis (Fujian large-headed frog)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Limnonectes kuhlii species complex, Limnonectes (genus), Dicroglossinae (subfamily), Dicroglossidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0050832 defense response to fungus; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVALPPGFTPLR
  • Length:  12(44-55)
  • Propeptide:  MFTIKKSILLLFFLGTISLSLCEQERDANEDETEGEAEVKNVKRVALPPGFTPLRVAPEIV
  • Signal peptide:  MFTIKKSILLLFFLGTISLSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  An antagonist of BK-induced relaxation of rat tail arterial smooth muscle
  • Mechanism:  Blocking BK interaction with B2-receptors
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 9.3nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0A8KZI7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004783_AF2.pdbhor004783_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 151998 Formula: C62H102N18O14
Absent amino acids: CDEHIKMNQSWY Common amino acids: P
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: 12.5 Boman Index: -1280
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 97.5
Instability Index: 5731.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  25268979
  • Title:  A Novel Bradykinin-Related Dodecapeptide (RVALPPGFTPLR) From the Skin Secretion of the Fujian Large-Headed Frog (Limnonectes Fujianensis) Exhibiting Unusual Structural and Functional Features